The store will not work correctly when cookies are disabled.
Solubility & Handling
| Storage instructions | -20°C |
| Solubility overview | Soluble in acidic buffer |
| Important | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use |
Chemical Data
| Molecular Formula | C205H340N60O53 |
| Sequence (one letter) | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Sequence (three letter) | H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH |
References for LL-37 (human) scrambled
References are publications that support the biological activity of the product
-
Human Cathelicidin Peptide LL-37 Induces Cell Death in Autophagy-Dysfunctional Endothelial Cells
Suzuki K et al (2022) J Immunol 208(9) : 2163-2172