GLP-1 (9-36) amide

(HB3050)

Certificate of Analysis

Latest Certificate of Analysis

Download the latest CoA for this product:

Download CoA

Download Batch-Specific CoA

To download the CoA for a batch, enter the batch ID below:

Technical documents: CoA SDS Datasheet

Product overview

Name GLP-1 (9-36) amide
Biological description

Major N-terminal truncated metabolite of glucagon-like peptide GLP-1 (7-36), formed by dipeptidyl peptidase-IV (DPP IV) cleavage. Acts as human GLP-1 receptor antagonist to inhibit hepatic glucose production. Also acts as a weak insulinotropic agent.

Purity >95%
Description

Major metabolite of GLP-1 (7-36)

Write Your Own Review
You're reviewing:GLP-1 (9-36) amide
Rate this item:

Solubility & Handling

Storage instructions -20°C
Solubility overview

Soluble in aqueous buffer

Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
Molecular Weight 3089.4
Molecular Formula C140H214N36O43
Sequence (one letter) EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence (three letter) H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Modifications C terminal amide
CAS Number 161748-29-4
PubChem identifier 90488821
InChiKey WPNGPBPCQMDAAD-WRFZDFFOSA-N

References for GLP-1 (9-36) amide

References are publications that support the biological activity of the product
  • Direct effects of exendin-(9,39) and GLP-1-(9,36)amide on insulin action, β-cell function, and glucose metabolism in nondiabetic subjects

    Sathananthan M et al (2013) Diabetes 62(8) : 2752-6
  • GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide

    Elahi D et al (2008) Obesity (Silver Spring) 16(7) : 1501-9
  • Glucagon-like peptide-1-(9-36) amide is a major metabolite of glucagon-like peptide-1-(7-36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor

    Knudsen LB et al (1996) Eur J Pharmacol 318(2-3) : 429-35

3 Item(s)

Publications
These publications cite the use of GLP-1 (9-36) amide purchased from Hello Bio:
  • Cerebellar interneurons control fear memory consolidation via learning-induced HCN plasticity.

    Carzoli KL et al (2023) Cell reports 42 : 113057
    PubMedID: 37656617

1 Item